<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16301
Description |
Putative cyclin-C-like |
Sequence | MYFKRVYSRYSLKSIDPLLLGPTCLFLATKVEESGLITNSKLQVACQSVVKKFGYAFKNQEFRYKSNQILECEFYLLELLDCCLIVYHPYRPLIQYVADLGQEEQLLPLAWKIVNDSLRTDVCLLYPPYLIALACLHMACVISQKDTKHWFAELNVDLDKVLEITQQILQLYDLWKNYNEREEISGILEKVPKPQLAPPNG |
Length | 201 |
Position | Kinase |
Organism | Stichopus japonicus (Sea cucumber) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.010 |
Instability index | 47.42 |
Isoelectric point | 5.95 |
Molecular weight | 23360.06 |
Publications | PubMed=29023486
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16301
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 129.09| 35| 51| 3| 37| 1
---------------------------------------------------------------------------
3- 36 (52.23/25.91) ....................FKRV.YSRYS..LKSIDPLLLGPTCLFLATKVEESGL
37- 84 (36.87/16.69) ItnsklqvacqsvvkkfgyaFKNQ.EFRY....KSNQIL....ECEFYLLELLDCCL
85- 118 (40.00/18.57) I.......................vYHPYRplIQYVADLGQEEQLLPLAWKIVNDSL
---------------------------------------------------------------------------
|