<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16300
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MGEQQAVSSTFPLPPMQYIANYSDEKVRNSAVPKPPLPAQDSYNMFGATFTSNDEIIRPLEAQGLTRLHPKYFRHKEELKKLNHSILVNFLELLEVLISCPGGGKREEKVEDINLLFVHMHHLINEYRPHQARETLRVMMEVQKRQRLQTAERFQKHLEKVTEILQGCFSSLPENVEHIDNILAVKLESNQEEEITNTTEKKEVSSIQKDRLMCNLVDSL |
Length | 220 |
Position | Middle |
Organism | Stichopus japonicus (Sea cucumber) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.563 |
Instability index | 53.64 |
Isoelectric point | 6.01 |
Molecular weight | 25461.84 |
Publications | PubMed=29023486
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16300
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.57| 21| 21| 36| 56| 2
---------------------------------------------------------------------------
36- 56 (38.00/24.38) PLPAQDSYNMFGATFTSNDEI
59- 79 (37.57/24.04) PLEAQGLTRLHPKYFRHKEEL
---------------------------------------------------------------------------
|