<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16297
Description |
Uncharacterized protein |
Sequence | MVNIQAILFCSPAGPTEPLSMTMLDSLSTHTKLSFIHHIATNKIGQVANRNTTLALSPAMMETYSRLLVYVELESLGIKTLISSETLSWTWCRGILEKLQTNTPHNWATHTLRCFPSSLQQFFEQNATQMENRTGLKELVDESYRSWSGLTTDQDKVAYFTGKGVSPHFLW |
Length | 171 |
Position | Tail |
Organism | Stichopus japonicus (Sea cucumber) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.177 |
Instability index | 37.77 |
Isoelectric point | 6.58 |
Molecular weight | 19328.88 |
Publications | PubMed=29023486
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16297
No repeats found
|