<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16293
| Description |
Putative transcription elongation factor S-II-like isoform X1 (Fragment) |
| Sequence | IIKGDTKFISHMLIITAVCTSQVEDYSKALDLLQELKAKKITLDVLQKTRIGMAVNNLRKKTSNEEVITLSKGLIKGWKKLLPTDNKNNGTSSTKEDAEGKKQGNSEEDSRKEDGKSSNSSSLAGENSVRKNVVR |
| Length | 135 |
| Position | Unknown |
| Organism | Stichopus japonicus (Sea cucumber) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.731 |
| Instability index | 37.84 |
| Isoelectric point | 9.52 |
| Molecular weight | 14863.76 |
| Publications | PubMed=29023486
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16293
No repeats found
No repeats found
|