<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16284
| Description |
Mediator of RNA polymerase II transcription subunit 14 |
| Sequence | MAPIVTPQSSMAPTPLTAAGQQGVQLGIPPPQGGGSISLSLLLDFLIQKTYHELTVLAELLPRKMDIERKEEIVKFAHSTRQSFIRFLALVKWAGSAAKVDKCSDISAFLDHQSHLFVDTADMLSRMSRENLVNARLPNFCLPHAVDVLTLGQYKRLPTCIKEKIIPPDPITPQEKASVLGRLDQIIQHRLVTSQLPSQLSNLSIKEGRVKFHIPQEFEATLTLMEDNPAIPWRLLNIKILVQDPDTGEGKSLVHPMQVTYIHQLVQSRLFDDGKPLWDMYTCLHTFCQSLQLEVLHSQAQRLVRERWGEHVTVEKYIPGQSLTLAYWRAQNLNSTKKQEHYKVVVCIDNSDAAKPLQIIHNPTLDAENAGRICSTSIKCERLSIERLLVETILVRSRTKLGSLKQKLEKIHVDATVGGTPPLLYIPLTASSEDADDDIRVSIDLQTGMLEPSVAHCDDAMIDDIDISLTSDLSKLPNLLTKIRLTHCVEKCKTSIQTMPVSCSDSIPLIPLQPEHPLSKLSPTRLYVYLKKHSSYYVVVEFSPPRSEDVTKVTVRYHLLRVRPAHSFEISNLPQPAEGLPPIQQYQDTSRAFTP |
| Length | 595 |
| Position | Tail |
| Organism | Stichopus japonicus (Sea cucumber) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.190 |
| Instability index | 41.83 |
| Isoelectric point | 7.06 |
| Molecular weight | 66814.48 |
| Publications | PubMed=29023486
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16284
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.98| 22| 25| 232| 253| 1
---------------------------------------------------------------------------
232- 253 (39.61/27.52) PWRLLNIKILVQDPDTGEGKSL
256- 277 (40.38/28.20) PMQVTYIHQLVQSRLFDDGKPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.09| 22| 27| 293| 314| 2
---------------------------------------------------------------------------
293- 314 (37.69/32.71) LEVLHSQAQRLVRERWGEHVTV
323- 344 (38.40/33.48) LTLAYWRAQNLNSTKKQEHYKV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.18| 21| 28| 437| 457| 3
---------------------------------------------------------------------------
437- 457 (37.61/22.60) DDIRVSI.....DLQTGMLEPSVAHC
463- 488 (30.57/17.12) DDIDISLtsdlsKLPNLLTKIRLTHC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.62| 13| 27| 151| 166| 4
---------------------------------------------------------------------------
151- 166 (18.06/19.38) LGqykRLPTCIKEKII
180- 192 (22.56/13.34) LG...RLDQIIQHRLV
---------------------------------------------------------------------------
|