<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16281

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMPSPMQRGGVPSPSTSLNTPGNPSSVGSVPSPGSAGRGPGSIGPHPSQEEQVQLREKQRQLALYMEQMKKQITFAKDQGDITKAQKVAHFVQHLSEISKTNDLARISQRLHQLSKSSGMPAHSSASAAATSAANSTKSNLMFQPLLNAITEQINSPHLNHNLQKAFSPALNKLHGTPSSFTAPILKKPPSDSSSSQGVPDVVQGEVARLPPKFRVALDPGHLPDSDSVHLLCKLEDEYLPSVPPVCVVIPEKYPSVNPQYNVNAFYCQTPFHQLVHKMLLTQLTHMPDLYTFTQLMDAWEMSVRKCCQAF
Length310
PositionTail
OrganismStichopus japonicus (Sea cucumber)
KingdomMetazoa
LineageEukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea> Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
Aromaticity0.05
Grand average of hydropathy-0.423
Instability index57.51
Isoelectric point8.91
Molecular weight33771.11
Publications
PubMed=29023486

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP16281
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.46|      14|      16|       8|      21|       1
---------------------------------------------------------------------------
    8-   21 (27.94/16.92)	GGVPSPSTSLNTPG
   27-   40 (28.51/17.43)	GSVPSPGSAGRGPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.60|      16|      21|     174|     189|       2
---------------------------------------------------------------------------
  174-  189 (29.47/18.54)	HGTPSSFTAPILKKPP
  196-  211 (28.13/17.37)	QGVPDVVQGEVARLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.20|      12|      14|      88|      99|       3
---------------------------------------------------------------------------
   88-   99 (20.55/13.63)	AHFVQHLSEISK
  104-  115 (18.65/11.77)	ARISQRLHQLSK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16281 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MPSPMQRGGVPSPSTSLNTPGNPSSVGSVPSPGSAGRGPGSIGPHPSQEEQVQLREKQRQLAL
2) SKTNDLARISQRLHQLSKSSGMPAHSSASAAATSAAN
1
98
63
134










Molecular Recognition Features






MoRF SequenceStartStop




NANANA