<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16281
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MPSPMQRGGVPSPSTSLNTPGNPSSVGSVPSPGSAGRGPGSIGPHPSQEEQVQLREKQRQLALYMEQMKKQITFAKDQGDITKAQKVAHFVQHLSEISKTNDLARISQRLHQLSKSSGMPAHSSASAAATSAANSTKSNLMFQPLLNAITEQINSPHLNHNLQKAFSPALNKLHGTPSSFTAPILKKPPSDSSSSQGVPDVVQGEVARLPPKFRVALDPGHLPDSDSVHLLCKLEDEYLPSVPPVCVVIPEKYPSVNPQYNVNAFYCQTPFHQLVHKMLLTQLTHMPDLYTFTQLMDAWEMSVRKCCQAF |
| Length | 310 |
| Position | Tail |
| Organism | Stichopus japonicus (Sea cucumber) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.423 |
| Instability index | 57.51 |
| Isoelectric point | 8.91 |
| Molecular weight | 33771.11 |
| Publications | PubMed=29023486
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16281
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.46| 14| 16| 8| 21| 1
---------------------------------------------------------------------------
8- 21 (27.94/16.92) GGVPSPSTSLNTPG
27- 40 (28.51/17.43) GSVPSPGSAGRGPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.60| 16| 21| 174| 189| 2
---------------------------------------------------------------------------
174- 189 (29.47/18.54) HGTPSSFTAPILKKPP
196- 211 (28.13/17.37) QGVPDVVQGEVARLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.20| 12| 14| 88| 99| 3
---------------------------------------------------------------------------
88- 99 (20.55/13.63) AHFVQHLSEISK
104- 115 (18.65/11.77) ARISQRLHQLSK
---------------------------------------------------------------------------
|