<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16270

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMNEDWKTPQHRRKIVEQIERKIQNPNKAREVEKASFSKAKTKEEYFIMVKNLLTHITGAKKENMVNMQQTTAGHNNVQDAMMAMQNLPNRGQGLAGNQQQQLQMGQPGMPGIQQTLQGQQQHINIQQNQLNLMRQKQLQQQQHTLQMHMNQQQQQQSVPIQQQQQPGMPQFNPNNMNQPQQIIRTAANFVSPTGQPPQNPMAPPAAPVFPGQPTPPQHQPGMVPSPAYAQQMSPAGQQPGSQPVLSPATYMQPSPTNQQSMPSPMQRGGVPSPSTSLNTPGNPSSVGSVPSPGSAGRGPGSIGPHPSQEEQVQLREKQRQLALYMEQMKKQITFAKDQGDIAKAQKVAHFVQHLSEIKNDLARISQRLHQLSKSSGMPLLNAITEQINSPHLNHNLQKAFSPALNKLHGTPSSFTAPILKKPPTDSSSSQGVPDVVQGEVARLPPKFRVALDPGHLPDSDSVHLLCKLEDEYLPSVPPVCVVIPEKYPSVNPQYNVNAFYCQTPFHQLVHKMLLTQLTHMPDLYTFTQLMDAWEMSVRKCCQAF
Length544
PositionTail
OrganismStichopus japonicus (Sea cucumber)
KingdomMetazoa
LineageEukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea> Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
Aromaticity0.05
Grand average of hydropathy-0.739
Instability index72.71
Isoelectric point9.45
Molecular weight60447.18
Publications
PubMed=29023486

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP16270
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.72|      17|      18|     187|     203|       1
---------------------------------------------------------------------------
  187-  203 (34.78/12.95)	ANFVSPTGQPP.QNPMAP
  229-  246 (24.94/ 6.81)	AQQMSPAGQQPgSQPVLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.19|      16|      18|     264|     281|       2
---------------------------------------------------------------------------
  269-  287 (19.59/ 6.41)	GVPSPSTSLNTPGnPSsvG
  288-  303 (25.60/ 6.36)	SVPSPGSAGRGPG.SI..G
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.23|      20|      21|      62|      82|       5
---------------------------------------------------------------------------
   62-   82 (32.30/21.55)	ENMVNMQQTTAGhNNVQDAMM
   85-  104 (36.93/19.87)	QNLPNRGQGLAG.NQQQQLQM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.86|      13|      37|     212|     226|       6
---------------------------------------------------------------------------
  212-  226 (24.34/11.71)	QPTPPQHQPgmVPSP
  252-  264 (27.52/ 8.39)	QPSPTNQQS..MPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|      91.49|      16|      21|     408|     423|       7
---------------------------------------------------------------------------
  369-  384 (21.76/ 9.24)	HQLSKSSGMPLLNAIT
  385-  400 (21.80/ 9.26)	EQINSPHLNHNLQKAF
  408-  423 (27.22/13.36)	HGTPSSFTAPILKKPP
  430-  445 (20.71/ 8.44)	QGVPDVVQGEVARLPP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16270 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MNEDWKTPQHRRKIVEQIERKIQNPNKAREVEKASFS
2) TGAKKENMVNMQQTTAGHNNVQDAMMAMQNLPNRGQGLAGNQQQQLQMGQPGMPGIQQTLQGQQQHINIQQNQLNLMRQKQLQQQQHTLQMHMNQQQQQQSVPIQQQQQPGMPQFNPNNMNQPQQIIRTAANFVSPTGQPPQNPMAPPAAPVFPGQPTPPQHQPGMVPSPAYAQQMSPAGQQPGSQPVLSPATYMQPSPTNQQSMPSPMQRGGVPSPSTSLNTPGNPSSVGSVPSPGSAGRGPGSIGPHPSQEEQVQLREKQRQLALYMEQMK
1
57
37
329










Molecular Recognition Features






MoRF SequenceStartStop




NANANA