Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSWSDSAWIPHLNQGNVMDYFSERSNPFYDRSCNNEVVKMQRRSPEHLKSMTGVEYELIHAQQPILFVIRKQRRHSPEQVTPLTFYYIIAGVIYQAPDLASIINSRLQGYWWEFKDQEKEKDSLSAKPKEEISSLFQRQRVDVLLAELTRSFPPKVYQPKPGDKPIPVSRSDPSGAIKEEVKEEINQSQNNANSSIPVTSRQAVRSWPPMSSDRVS |
Length | 216 |
Position | Head |
Organism | Stichopus japonicus (Sea cucumber) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea> Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.738 |
Instability index | 69.46 |
Isoelectric point | 8.57 |
Molecular weight | 24967.86 |
Publications | PubMed=29023486 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16269 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.56| 18| 52| 129| 154| 1 --------------------------------------------------------------------------- 129- 154 (28.09/30.55) KEEI..S........SLFQRQRVdvllaeltRSFPP 182- 209 (24.47/12.51) KEEInqSqnnanssiPVTSRQAV........RSWPP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IKEEVKEEINQSQ 2) SSIPVTSRQAVRSWPPMSS | 177 194 | 189 212 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab