| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSWSDSAWIPHLNQGNVMDYFSERSNPFYDRSCNNEVVKMQRRSPEHLKSMTGVEYELIHAQQPILFVIRKQRRHSPEQVTPLTFYYIIAGVIYQAPDLASIINSRLQGYWWEFKDQEKEKDSLSAKPKEEISSLFQRQRVDVLLAELTRSFPPKVYQPKPGDKPIPVSRSDPSGAIKEEVKEEINQSQNNANSSIPVTSRQAVRSWPPMSSDRVS |
| Length | 216 |
| Position | Head |
| Organism | Stichopus japonicus (Sea cucumber) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea> Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.738 |
| Instability index | 69.46 |
| Isoelectric point | 8.57 |
| Molecular weight | 24967.86 |
| Publications | PubMed=29023486 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP16269
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.56| 18| 52| 129| 154| 1
---------------------------------------------------------------------------
129- 154 (28.09/30.55) KEEI..S........SLFQRQRVdvllaeltRSFPP
182- 209 (24.47/12.51) KEEInqSqnnanssiPVTSRQAV........RSWPP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IKEEVKEEINQSQ 2) SSIPVTSRQAVRSWPPMSS | 177 194 | 189 212 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab