<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16267
Description |
Mediator of RNA polymerase II transcription subuni t 25 |
Sequence | MFGSNNSICLYCRYFNGGPLVESSYSGQYGNKHFSLVVYNSVDYIPSQTVFCHPPTSSAWEVLRSMDEIRFVGGGGESKSLLSEGLASALQIFDDIEKHHRKWISCLYTYSVNVFEVYAKFDCSWSNFGACFKALRVFKSFLLGDPDY |
Length | 148 |
Position | Unknown |
Organism | Stichopus japonicus (Sea cucumber) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
Aromaticity | 0.17 |
Grand average of hydropathy | -0.076 |
Instability index | 38.47 |
Isoelectric point | 6.04 |
Molecular weight | 16743.71 |
Publications | PubMed=29023486
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16267
No repeats found
No repeats found
|