<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16265
Description |
Mediator of RNA polymerase II transcription subunit 13 (Fragment) |
Sequence | MVFPTSATKQDASATYQSEPIMDLTFPNPVDNVPLGDDLFNDSDIVRSLFENPIMDDVRSPTQLDHPQGSPSLLPAMNSIGIDSGIKNSSGLPENVLPVDAENVLQQPLALGYFVSTAKAGTSPSGFGRPVRRLKQTVPSSSRLPCMLIMALCNRLQMIFIKSLTPTRWILQNHGCAK |
Length | 178 |
Position | Middle |
Organism | Stichopus japonicus (Sea cucumber) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.140 |
Instability index | 67.49 |
Isoelectric point | 5.59 |
Molecular weight | 19339.97 |
Publications | PubMed=29023486
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364134
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16265
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.69| 17| 31| 19| 36| 1
---------------------------------------------------------------------------
19- 36 (29.81/20.73) EPIM.DLTFPNPVDNvPLG
52- 69 (29.87/16.33) NPIMdDVRSPTQLDH.PQG
---------------------------------------------------------------------------
|