<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16259
| Description |
Mediator of RNA polymerase II transcription subuni t 29 |
| Sequence | MAAPPGAQGIPAGPPQTGEAQASSAQSQQQQQQHFGDPINKAKIYMSQLKENLAKLMKVAAASFQNAVDSESKAKEDPGQAQFDKCLEDFYAVCDQIEIFLKLSLECAIHSAESSRHTPHPQTAKPNSLDTQLYSQLISTVKTQISCAQEVHDLLMECSKRLEERKS |
| Length | 167 |
| Position | Tail |
| Organism | Stichopus japonicus (Sea cucumber) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.586 |
| Instability index | 59.70 |
| Isoelectric point | 5.71 |
| Molecular weight | 18287.38 |
| Publications | PubMed=29023486
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16259
No repeats found
No repeats found
|