<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16258
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MNAGLVTEQQDPEKLRFQVELEFVQCLANPHYLNFLAQRDYFKDSRFVNYLKYLQYWKDPHYAKFLKYPQCLHFLELLQYESFRKELANAQCVRFIEDQQLLHWQHYSYKRMRLQQSHLDNLHQQHAQQQQQQQQQQSTHQQTTQQQSGMLPPPQQQPASSQATGLPFAGLQPQHHQPGQPLQSQTRLLQMDQKPLQSLPQNSLNTK |
| Length | 207 |
| Position | Middle |
| Organism | Stichopus japonicus (Sea cucumber) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -1.005 |
| Instability index | 77.83 |
| Isoelectric point | 8.72 |
| Molecular weight | 24683.47 |
| Publications | PubMed=29023486
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16258
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.93| 28| 28| 9| 36| 2
---------------------------------------------------------------------------
9- 27 (27.02/10.63) ..........QQDPEK.LRFQVELE.FVQCL
28- 57 (45.56/21.78) ANPHYLNFLaQRDYFKdSRFVNYLK.YLQYW
58- 72 (25.35/ 9.63) KDPHYAKFL................kYPQCL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.55| 15| 19| 151| 166| 3
---------------------------------------------------------------------------
151- 166 (25.10/13.37) LPPPQQQPAS...SQaTGL
171- 188 (24.45/ 9.15) LQPQHHQPGQplqSQ.TRL
---------------------------------------------------------------------------
|