<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16252

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMDFPGGSVTNIRVLDGFSNIYWRIYTEDPNITNLPGEAPANGFTILKHLSRLKDLELRLRNSDCLVSSYPRRLGLWVFSATPEFESVRSLRSDESKGEQSRLVVGSSTLKVSASGSVTPRELVKNLSTDPQTAGGSTGSQRPQGTPTPTRRVDSYSSSVAIYAAFISAITGSLNLQLIRRSSAIPLGSRTLFTVIERDYYETSRIVNDDPSSISALTTLQVQLTSAGKLTVSLQTTSQPGIAPLCRLGESPSDIRDVAPGADIWLSPSGSVARLVSINPGPPNASSPLPHTGSIGIDSFGAAGRKQWKANVLEWLRNFGLLIDSVDETAWVEVEVWEPFYSRLAGETLRLNEDNSSTLPLKHVLWPAVYCFRRTKSASPGSSQWMDSACPVVGDPLDFAENWRVMEKPKQDETSPKPPSSHPEQQSRNPEPSAATTDILEGIESLSRASEYPDLQTVSLVYPTPPDGAAAMGLNLTGPSDTFAEEPDLVPSLLQNQSKPKYYEQLTTKDRSETDPSAGFGPLGGLAVGSGLYDTNEDDDLFGDMDEKDFGTKGITDADFNFFDDPSFAAMDTDVPADDAQDVPDMVNLEVTEAHPTISDDALLEDFAAQKTPAEILEVAQASPDEVTPEVQPEHMDAEETTVAASPHTEQNQTISPPLSPVEIKRILLPEPEGDNHVPTKGSRKQSYYNPVAFKLNMSAWDQKYGADGKFRFTTAGPSGSKVYTDSDIPTVGMPRRNKKYPTAGAGLMSLDGHASPSSEGQHLQAVSDSSSDTSDDSDGSALESDAPPLLSRKRKRARSNSVGSPAISQVKSLGEAEQEIPVHRPEHSIFLGNLLSTFSDWSMTGYFSLTENRLFPVLTRKDMQIHIAQLFVDQITQSSLDHKLDGGFCLSDLDTKAYSVQTFFEEEGILGGIERLDLNSWISLQDNEQASPAPNGAVSRQSSQRKEMGKGSITKLSPPHLRVRRGKEYLEALPPAISFWETFGLEPADGPKDISAYCIHPQIAGDAADVFLERLGLLYASCNLGKHVRGCRSSAFERGLYSWDVGSLETAHCLPAMQSLKVICEELGTALLKGSPSNDSLVIYIINPFAHASALVDICSAFWCLFQKYIADTGKQQARQLNEVVLQIIPISFIMSTGSVVVPLQAQYLNLALEIYSRCPPKALQSSLVNCAPPVLLAEPLPRTISFRLASEKTSPLQEGKCLHIAYSKSQDQRWIGVAWSDNSGALQRTISYNLRYRNASAVRSISDVRSEIWVATKDILDRIQARWKVFVVSTEPVDQDEVDAWTSFIEQYNKANSIPLELTILSVNTAPDLHLEPPFLPMSMSIFNPQTSSTPVATPNASGNVFSPDQSGTAPTPPSGGNAPANAPTPTEPTLEAETESVLTDICDDSWGVILSHRLNNSPHLTEYRPALASGYLLRRKGDTDGDGVYAMTLNLIYTQRPSSCEAILRETLGMYRDLGTLARARGTRTVQRNTLPWHIATAVRAQEMLSHVL
Length1495
PositionKinase
OrganismAspergillus arachidicola
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.07
Grand average of hydropathy-0.345
Instability index55.35
Isoelectric point4.96
Molecular weight162965.61
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16252
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     209.56|      34|      34|     754|     787|       1
---------------------------------------------------------------------------
  418-  444 (26.21/ 8.81)	..PS..SHPEQQ..SRNPEPSAATTDIL...E..G..IES...
  446-  478 (31.42/12.16)	...SraSEYPDL..QTVSLVYPTPPDGA...A..AMGLNLTGP
  513-  548 (29.28/10.78)	TDPS..AGFGPLggLAVGSGLYDTNEDD...DlfGDMDEKD..
  550-  575 (29.77/11.10)	........G..T..KGITDADFNFFDDP...S..FAAMDTDVP
  581-  614 (38.73/16.86)	DVP....DMVNL..E.VTEAHPTISDDAlleD..FAAQKTPAE
  754-  787 (54.13/26.77)	ASPS..SEGQHL..QAVSDSSSDTSDDS...D..GSALESDAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.65|      19|      22|     998|    1019|       3
---------------------------------------------------------------------------
  998- 1019 (23.59/26.61)	C.IHPQIAGDAADVFlERlGlLY
 1022- 1041 (33.06/19.78)	CnLGKHVRGCRSSAF.ER.G.LY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.69|      25|      34|     672|     704|       4
---------------------------------------------------------------------------
  672-  697 (42.60/21.82)	EG................DNHVPTKG.SRKQSYYnPVAFKLNM
  707-  748 (33.09/22.29)	DGkfrfttagpsgskvytDSDIPTVGmPRRNKKY.PTAGAGLM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.06|      14|      15|     945|     959|       5
---------------------------------------------------------------------------
  945-  959 (21.47/16.17)	RKEMGKGSITKLsPP
  962-  975 (25.58/14.52)	RVRRGKEYLEAL.PP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.04|      14|      34|      79|      93|       6
---------------------------------------------------------------------------
   79-   93 (19.82/16.57)	SATPEfESVRSLRSD
  116-  129 (24.22/14.41)	SVTPR.ELVKNLSTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.60|      36|     516|     360|     417|       8
---------------------------------------------------------------------------
  167-  212 (46.33/15.55)	SAITGSlnLQLIrrSSAIPLGSRTLftvierDYYETSRIV...NDDPSS
  376-  414 (64.27/40.61)	SASPGS..SQWM..DSACPVVGDPL......DFAENWRVMekpKQDETS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.55|      17|      21|    1255|    1272|       9
---------------------------------------------------------------------------
 1255- 1272 (25.21/20.31)	VATKDI.LDRIQArWKVFV
 1273- 1290 (26.34/15.75)	VSTEPVdQDEVDA.WTSFI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.86|      36|     516|     265|     302|      11
---------------------------------------------------------------------------
  223-  258 (59.98/27.66)	LTSAGKLT..VSLQTTSQPGIAPLCRLGESPSDIRDVA
  265-  302 (57.88/31.18)	LSPSGSVArlVSINPGPPNASSPLPHTGSIGIDSFGAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.75|      32|      34|       4|      35|      17
---------------------------------------------------------------------------
    4-   35 (57.11/41.97)	PGGSVTNIRVLDGFSNIYWRIYTEDPNITNLP
   39-   70 (53.64/38.90)	PANGFTILKHLSRLKDLELRLRNSDCLVSSYP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16252 with Med13 domain of Kingdom Fungi
Unable to open file!