<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16249
Description |
Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MADILTQLQTCLDQLATQFYATIGYLVTYHDNSPAIPPQNDPTAAPALAKITKNSTAPPVPAGAPAGSQASPQQQSAQIPGQQQQGGGDAGQTPGAGGGSGGTGADPNLPPAPDSPRTFASRQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERRIKELEKELRSAEEDREQRVRELRKLRKKLENVLGAVEVGIYGDRGVVASRR |
Length | 208 |
Position | Middle |
Organism | Aspergillus arachidicola |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.637 |
Instability index | 66.63 |
Isoelectric point | 5.35 |
Molecular weight | 22202.48 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16249
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.82| 15| 16| 151| 166| 1
---------------------------------------------------------------------------
151- 166 (20.83/18.14) EAEQERRIKELEKeLR
169- 183 (25.98/17.36) EEDREQRVRELRK.LR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.49| 17| 17| 45| 61| 2
---------------------------------------------------------------------------
45- 61 (30.39/14.14) APALAKITKNSTAPPVP
64- 80 (28.09/12.60) APAGSQASPQQQSAQIP
---------------------------------------------------------------------------
|