<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16221
| Description |
Uncharacterized protein |
| Sequence | MSANAQKKAASRSMATKKLIIDEFKRRLRDNIKSLNDNFYHIIQAAKVNPDDNAFKNQTGKMTEFYTIKNEMAVRAQLMVRASDELLRLTTDLKEFLILHDFHFLTHNIKQAESQCEETLRQQSHLHQALDTDVSNMLFALEEEIADNFFLGH |
| Length | 153 |
| Position | Head |
| Organism | Caenorhabditis nigoni |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.517 |
| Instability index | 51.70 |
| Isoelectric point | 6.37 |
| Molecular weight | 17771.02 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16221
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.17| 14| 30| 84| 97| 1
---------------------------------------------------------------------------
84- 97 (22.31/14.39) DELLRLTTDLKEFL
117- 130 (23.86/15.80) EETLRQQSHLHQAL
---------------------------------------------------------------------------
|