<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16219
| Description |
Uncharacterized protein |
| Sequence | MSGQGPPSNLTPQQQHMIMQQQQQQQMMRQQQIQQQQLHQRQLQQQQAQQQQSYQRSRTPQMQQHPGGGSPGSHLQMHPHLQSQGHMQPRSPLVGQHHPAPGSIPPGNPATPQMMQQQMGMNQPMSLPAPHVSRPGSVAPPASVPPNMHTGPSSNQMDQMGGGQPQYSHHLQPQQPLSRPGSQQSHIAGGHGGPHSVQQPGSIQRPGSVLAPGSIQQPGSLLAPGSIQQPGSVLAPGSIQQPGSLLAPGSMHQPGSVQQPGSLGAPLSHTGAGGPQSVQGYGPGSVQPPGSAQAPSSVQPGSTFAPGSLQAPASQQPPASIQPPPSAASGSVAGPASAAPAKVEPLKPNEEQIRMVQDPVDLVRNLVQKDLRMSVVEMNKRGAELLHQKEEGAIKEEDRQQYKRATNDFHAVCDEIDRTLTTIMETAKQITKLDKVFQDRTSKEIDGEAMVNSVQKFVDETGIVQKMFDDTVNSVTSTMEKMRRRQKKWEDQQQQQENAEDMEMAE |
| Length | 506 |
| Position | Tail |
| Organism | Caenorhabditis nigoni |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.882 |
| Instability index | 74.03 |
| Isoelectric point | 7.07 |
| Molecular weight | 54454.27 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16219
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
7| 271.98| 22| 22| 200| 221| 1
---------------------------------------------------------------------------
101- 127 (33.53/ 8.06) PGSIP.PGNPATPQMMQQqmgmnqPMSL
200- 221 (47.87/14.61) PGSIQRPGSVLAPGSIQQ......PGSL
224- 245 (47.62/14.50) PGSIQQPGSVLAPGSIQQ......PGSL
248- 263 (34.17/ 8.35) PGSMHQPGSV......QQ......PGSL
275- 292 (36.94/ 9.62) PQSVQGYG....PGSVQP......PGSA
295- 315 (37.76/ 9.99) PSSVQ.PGSTFAPGSLQA......PASQ
318- 338 (34.10/ 8.33) PASIQPPPSA.ASGSVAG......PASA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.06| 22| 26| 13| 36| 2
---------------------------------------------------------------------------
28- 50 (36.11/10.44) MRQQQIQQQQLHQRqLQQQQ......AQQ
157- 184 (36.95/ 8.08) MDQMGGGQPQYSHH.LQPQQplsrpgSQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.83| 15| 30| 52| 66| 3
---------------------------------------------------------------------------
52- 66 (31.51/14.37) QSYQRSRTPQM.QQHP
84- 99 (26.32/10.65) QGHMQPRSPLVgQHHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.02| 19| 19| 452| 470| 4
---------------------------------------------------------------------------
452- 470 (32.68/22.96) NSVQKFVDETGIVQKMFDD
473- 491 (33.34/23.56) NSVTSTMEKMRRRQKKWED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.13| 15| 21| 380| 399| 8
---------------------------------------------------------------------------
380- 399 (19.96/23.23) KRGAELLHqkeegAIKEE.DR
403- 418 (24.17/14.26) KRATNDFH.....AVCDEiDR
---------------------------------------------------------------------------
|