<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16180
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MATTSATQLDEQVYTFPPLIEWWVNTMGQKAMDENMIHRYMSESPFFEWSSKNGLLFEQGKFHSPTHDMCNNRKALEDNLRGRVGLEYMIVQDPQPVADKELAAQGVTTGVYVIRKQDRQRAPSGARVRPPGVILEGNWELTVLGTYYTMGQNVYQAPNMFDVVENRLLSAASSLNKFIDTTSILPRYAPATGYTYLPPSQPSKRIGTGSIAGSPAGSREGSVVPGLDSQSFRSGSLLPDSNVSTSKATSDHDQTRLLASSLAMSIKYAHDYTDENPLVGEPGNFKFAMTEAAVKKRGAEEEAAAAEARAKKELASNSRGVSPRQDSASPKADKAVAPAAFSTETKLKAEEKRKNSASGGKRKKDRKKGMSSAGPSPTTPGPSTAPTPKAS |
| Length | 391 |
| Position | Head |
| Organism | Cercospora beticola (Sugarbeet leaf spot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Cercospora.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.626 |
| Instability index | 49.78 |
| Isoelectric point | 9.20 |
| Molecular weight | 42316.00 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16180
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.90| 21| 25| 291| 315| 1
---------------------------------------------------------------------------
295- 315 (31.36/22.94) KKRGAEEEAAAAEARAKKELA
317- 337 (34.54/16.10) NSRGVSPRQDSASPKADKAVA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.60| 18| 88| 112| 137| 2
---------------------------------------------------------------------------
115- 132 (35.17/27.23) RKQDRQRAPSGARVRP..PG
362- 381 (30.43/ 7.31) RKKDRKKGMSSAGPSPttPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.84| 13| 23| 199| 211| 4
---------------------------------------------------------------------------
199- 211 (24.26/15.72) PSQPSKRIGTGSI
225- 237 (21.58/13.18) PGLDSQSFRSGSL
---------------------------------------------------------------------------
|