Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MREYLLYSQIPAAREEQVLSILAGISSNQPTPINEQILLYAQLKAQEAAVSKRQPQPKTTVTQPLSYHRLVRGFNVDGDTATNVQPWTFRAESVPDTGITTYISRNTTSQPATPEQLSLFKQPQSYHLKRQYVQSGSRFVHHNLIIKVIRFYSNPPETATPPQDPLAETSPPRTSSQLKLIDASGSFIIEVSICVDDPTNSTLTEAAVAELTRFKSTLDGAIDLIAPDRLLLDTRVKGNPMGIASGA |
Length | 247 |
Position | Head |
Organism | Cercospora beticola (Sugarbeet leaf spot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Cercospora. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.343 |
Instability index | 40.06 |
Isoelectric point | 6.91 |
Molecular weight | 27216.44 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16173 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 189.89| 56| 58| 63| 119| 1 --------------------------------------------------------------------------- 63- 119 (96.88/52.19) QPLSYHrLVRGFNVDGD..TATNVQPWTFRAES.VPDTGITTYISRNTTSQPATPEQLSL 122- 180 (93.01/46.48) QPQSYH.LKRQYVQSGSrfVHHNLIIKVIRFYSnPPETATPPQDPLAETSPPRTSSQLKL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IIKVIRFY 2) MREYLLY | 145 1 | 152 7 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab