<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16156
Description |
Uncharacterized protein |
Sequence | MDWRSELENDGGRQRLVNNILDTMKLQYPVLTPEELVQLQTSAVAFEETNFVGATSQLDYFEKISLKMLTEAKKIRDTSVANSFPQNPVVSNPNPPSPGNTPRSWHILLTVLLLPFCS |
Length | 118 |
Position | Tail |
Organism | Aquilegia coerulea (Rocky mountain columbine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.301 |
Instability index | 57.91 |
Isoelectric point | 5.04 |
Molecular weight | 13289.99 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16156
No repeats found
No repeats found
|