Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDISQNSSASAANANGGITQTNDQDESKQNLNHVINSIDKTLGLLHQLHLTVSSFNVASQLPLLQRVNSLVTELDTMQRLADNCNIQVPMEVVNLIDEGKNPDEFNRDVINSCIAKNQITKGKTDQFKGLRRHLLEELDQAFPNEVEAYREIRATSAAVSRIKS |
Length | 164 |
Position | Middle |
Organism | Aquilegia coerulea (Rocky mountain columbine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae> Aquilegia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.480 |
Instability index | 27.78 |
Isoelectric point | 5.33 |
Molecular weight | 18199.15 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16155 No repeats found |
MoRF Sequence | Start | Stop |
1) AYREIR 2) GLRRHLLE | 148 129 | 153 136 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab