<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16150

Description Uncharacterized protein
SequenceMSSNPQSSGTQVPRPPLVGSVGSQNFMQFQPGAAQQQQQQQTQSFIPAGSQQFRPVAQGQQMHFSQTMQQVPLRPPSSQAFSMSYGQPNMPVAAASTQPQHSTQGVGGFGMAPSSSYTFTPSPYGQPPNSINMSAQYQPSSQMNASVIPVGGQPWLSSGSQSIPVATHMEQPTGQQPSVMVSTISAAHAQTNPSIPSSSDWQEHTAADGRRYYYNKKTRQSSWEKPVELMTPLERADASTVWKEFATQDGRKYYYNKDTKESKWTIPEELKLAREQAEKMSSQGTHTDTAVASQAHVSVNVSTVEVSSNSASAMSGVISSPVSVTPVVPAANSLPLVALGSQSTPISTSSVSLNFVGGHSPVASITPSHASVTGTGIPADLATSATLMNVSDNVHSQDVPNSANGASIQDLEEAKKGMTVAGKVNVTIQEDKTVDDEPFPYPSKQEAKNAFKALLESANVESDWSWDQAMRIIVNDKRYGALKTLGEKKQAFNEYLGQRKKQEAEERRIKQKKAREEFTKMLEESKELTSSTRWSKAISMFEEDERFKAVERPRDREDLFESYIVELQKKEREKAQEEHQENLMEYRRFLESCGFIKVDSLWRKVQDRLEDDERCSRLEKIDRLEGFKEYIRDLEKEEDEQKKIHKEKVRRTERKNRDDFLKLMEEDVATGVLTAKTHWRDYCIKVKETPEYMAVALNTSGSTPKDLFEDVVEDLEKQYHDDKYRIKDSIKLKKITLTSTWTLEDLQDAISDEVSSPQISNINFKLVYDELLERIKEKEEKEAKKRQRLADDFTDLLYSIKEITASSIWEDSRQYFEDSQEYRSIGEESLKREIFEEYISLLLEKAKEKELKREEEKKEKEKEEKEKKKEKEKEKERKEKEKEREREKGKERSKKDENEDDSVDVTDVKEEKRKEKDRDRKHRKRHQSAADDLSSEKDEKEDSKKSRRHSSDRRKSRKVAIY
Length962
PositionUnknown
OrganismAquilegia coerulea (Rocky mountain columbine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae> Aquilegia.
Aromaticity0.07
Grand average of hydropathy-1.034
Instability index53.72
Isoelectric point5.99
Molecular weight109724.85
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process
mRNA cis splicing, via spliceosome	GO:0045292	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16150
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     143.64|      37|      40|     201|     238|       1
---------------------------------------------------------------------------
  201-  237 (72.87/42.49)	WQEHTAADGRRYYYNKKTRQSSWEKPVELMTPLERAD
  242-  278 (70.77/37.18)	WKEFATQDGRKYYYNKDTKESKWTIPEELKLAREQAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     229.66|      42|      42|     859|     900|       2
---------------------------------------------------------------------------
  498-  537 (39.00/15.86)	.QRKKQEAEE.RRIKQKK..............AREE...FTKMLE...ESKElTSS...................TRWSKA
  542-  607 (37.96/15.22)	EEDERFKAVE.RPRDREDlfES.......yivELQK...KEREKA...QEEH.QENlmeyrrflescgfikvdslWRKVQD
  608-  658 (40.99/17.06)	RLED....DE.RCSRLEK..IDrlegfkeyirDLEK...EEDEQKkihKEKV.RRT...................ERKNRD
  859-  881 (26.40/ 8.21)	................................EKEK...EEKEKK...KEKE.KEK...................ERKEKE
  882-  922 (47.49/21.00)	KEREREKGKE.RSKKDEN..ED..............dsvDVTDVK...EEKR.KEK...................DRDRKH
  923-  958 (37.83/15.14)	RKRHQSAADDlSSEKDEK..ED.................SKKSRR...HSSD.RRK...................SRK...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|      77.90|      12|      18|      55|      66|       3
---------------------------------------------------------------------------
   31-   43 (17.76/ 9.58)	PgA..AQQQQQQQTQ
   55-   66 (24.98/17.06)	P.V..AQGQQMHFSQ
   76-   87 (18.89/10.74)	P.S..SQAFSMSYGQ
   91-  104 (16.27/ 8.03)	P.VaaASTQPQHSTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|      88.76|      17|      18|     333|     349|       4
---------------------------------------------------------------------------
  153-  167 (17.65/ 6.52)	.QPWLSSGSQSIPVAT.
  293-  309 (21.24/ 9.17)	SQAHVSVNVSTVEVSSN
  310-  325 (22.54/10.13)	SASAMS.GVISSPVSVT
  333-  349 (27.33/13.67)	SLPLVALGSQSTPISTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.39|      24|      24|     768|     791|       5
---------------------------------------------------------------------------
  768-  791 (39.21/23.78)	YDELLERIKEKEEKE..AKKRQRLAD
  793-  818 (33.18/18.83)	FTDLLYSIKEITASSiwEDSRQYFED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      27.32|       9|      19|     827|     837|       6
---------------------------------------------------------------------------
  827-  837 (11.25/13.51)	EESLKREifEE
  848-  856 (16.08/ 9.29)	EKELKRE..EE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.00|      13|      23|     113|     125|       7
---------------------------------------------------------------------------
  113-  125 (26.12/16.36)	PSSSYTFTPSPYG
  139-  151 (23.88/14.34)	PSSQMNASVIPVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      54.23|      13|      17|     380|     392|       8
---------------------------------------------------------------------------
  380-  392 (20.70/14.40)	DLATSATLMNVS.......D
  398-  410 (20.49/14.18)	DVPNSANGASIQ.......D
  416-  435 (13.04/ 6.33)	KGMTVAGKVNVTiqedktvD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.21|      31|      39|     676|     714|       9
---------------------------------------------------------------------------
  676-  714 (41.39/47.35)	KTHWRDY....CIKVKEtpeymaVALnTSGSTPKDLfEDVVED
  718-  752 (48.82/29.25)	QYHDDKYrikdSIKLKK......ITL.TSTWTLEDL.QDAISD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      46.69|      10|      39|     446|     455|      12
---------------------------------------------------------------------------
  446-  455 (15.75/12.40)	EAKNAFKALL
  477-  486 (14.68/10.91)	KRYGALKTLG
  487-  496 (16.25/13.10)	EKKQAFNEYL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16150 with Med35 domain of Kingdom Viridiplantae
Unable to open file!