<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16144
| Description |
Uncharacterized protein |
| Sequence | MDSTVDALNSSYQEFVAAAAGVLEAKESSGGQKTALTDSALENFKQKWELFRVACDQAEEFIECIKQRISSECLVDEATGSVSSRPGQTATTATTGLPPISAVRLEQMSKAVRWLVIELQQGSGASASNTHSSAPFDARFSEDAAQ |
| Length | 146 |
| Position | Tail |
| Organism | Aquilegia coerulea (Rocky mountain columbine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.273 |
| Instability index | 64.15 |
| Isoelectric point | 4.60 |
| Molecular weight | 15552.01 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16144
No repeats found
No repeats found
|