<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16140
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAATATYPPPPPYYRLYKDYLQNPKSAPEPPPPIEGTYVLYGATYTTDDVLPSLEDQGVRQLYPKGPHVDFKKELRALNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAIEDIKRRREEAQKLLKESLVTLDGH |
| Length | 169 |
| Position | Middle |
| Organism | Aquilegia coerulea (Rocky mountain columbine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.611 |
| Instability index | 68.62 |
| Isoelectric point | 8.73 |
| Molecular weight | 19619.30 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16140
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.62| 27| 45| 75| 113| 2
---------------------------------------------------------------------------
75- 107 (32.16/42.52) LRALN.RELQLHILELaDVlvERPSQyarRVEDI
121- 148 (43.46/20.63) LRPHQaRATLIHILEL.QI..QRRKQ...AIEDI
---------------------------------------------------------------------------
|