<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16138
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAATATYPPPPPYYRLYKDYLQNPKSAPEPPPPIEGTYVLYGATYTTDDVLPSLEDQGVRQLYPKGPHVDFKKELRALNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQKKRGSTKIAEGVSCYFGWALA |
| Length | 146 |
| Position | Middle |
| Organism | Aquilegia coerulea (Rocky mountain columbine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.519 |
| Instability index | 52.39 |
| Isoelectric point | 8.59 |
| Molecular weight | 16673.89 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16138
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.33| 10| 19| 32| 41| 2
---------------------------------------------------------------------------
32- 41 (20.24/11.67) PPIE..GTYVLY
52- 63 (14.08/ 6.41) PSLEdqGVRQLY
---------------------------------------------------------------------------
|