<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16137
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MAATATYPPPPPYYRLYKDYLQNPKSAPEPPPPIEGTYVLYGATYTTDDVLPSLEDQGVRQLYPKGPHVDFKKELRALNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAIEDIKRREEAQKLLKESLVTLDGH |
Length | 168 |
Position | Middle |
Organism | Aquilegia coerulea (Rocky mountain columbine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.588 |
Instability index | 65.56 |
Isoelectric point | 7.95 |
Molecular weight | 19463.11 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16137
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.49| 16| 45| 75| 99| 2
---------------------------------------------------------------------------
69- 84 (22.80/ 7.09) VDFKKELRALNRELQL
94- 109 (24.69/30.22) VERPSQYARRVEDISL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.33| 10| 21| 32| 41| 3
---------------------------------------------------------------------------
32- 41 (20.24/11.98) PPIE..GTYVLY
52- 63 (14.08/ 6.54) PSLEdqGVRQLY
---------------------------------------------------------------------------
|