<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16128
Description |
Uncharacterized protein |
Sequence | MDWKSELESGGGRQRLVNNIVHTMKLQYSALTAEELVKLQTSAVAFEETIFVGATSQSDYFEKISSKMLTEAKKIRDTSVANLLPPNPVVSNPNPPSPAMAESGQADTADWQEEAYQKIKAMKEMYLPDLLEMHHKLSVKFQQHETVARQPKDQMDKLRLMKIYLERIITFLQVSKNNIPLTHRDKLPGYEKQIISFLNSNRTKKPVSANQQILQYGGHPPLFVIPQ |
Length | 227 |
Position | Tail |
Organism | Aquilegia coerulea (Rocky mountain columbine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.522 |
Instability index | 46.67 |
Isoelectric point | 8.91 |
Molecular weight | 25836.42 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16128
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.52| 24| 27| 147| 173| 1
---------------------------------------------------------------------------
147- 173 (36.98/29.42) VARQ..PKDQMDKLrlmKIYLERIITFLQ
174- 199 (38.54/22.61) VSKNniPLTHRDKL...PGYEKQIISFLN
---------------------------------------------------------------------------
|