<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16121

Description Uncharacterized protein
SequenceMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPINTVFDAKRLIGRRISDASVQSDMKLWPFKIVAGPGEKPMICVNYKGEEKQFAAEEISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKATSVGEKNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHEVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLDPADKKKIEDAIEAAIQWLDSNQLAEADEFEDKMKELESLCNPIIAKMYQGAGADMGGAGMDEDGPSAGEIFSFWSLLSLPVFFDGVLAICVLVLFFICLGSVPVFFDGGLI
Length680
PositionUnknown
OrganismAquilegia coerulea (Rocky mountain columbine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae> Aquilegia.
Aromaticity0.07
Grand average of hydropathy-0.244
Instability index34.70
Isoelectric point5.07
Molecular weight74717.36
Publications









Function






Annotated function


GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16121
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.90|      15|      21|     642|     656|       1
---------------------------------------------------------------------------
  642-  656 (31.13/24.47)	FWSLLSLPVFFDGVL
  665-  679 (31.77/25.15)	FICLGSVPVFFDGGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      92.96|      25|      26|     572|     596|       4
---------------------------------------------------------------------------
  539-  568 (19.52/ 7.67)	.K.KKVEskNALEnysyNMRNTIKDEKIASKL
  572-  596 (40.21/22.20)	DK.KKIE..DAIE....AAIQWLDSNQLAEAD
  600-  623 (33.23/17.31)	DKmKELE..SLCN....PIIAKM..YQGAGAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.92|      18|      41|     337|     356|       5
---------------------------------------------------------------------------
  337-  356 (25.26/23.22)	VHEVVLVGGSTRipKVQQLL
  381-  398 (29.66/19.13)	VQAAILSGEGNE..KVQDLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.78|      12|      26|     163|     174|       6
---------------------------------------------------------------------------
  163-  174 (18.93/13.10)	KDAGVIAGLNVL
  191-  202 (18.86/13.02)	KKATSVGEKNIL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16121 with Med37 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KEEIEKMVQEAEKYKSEDEEHKKKVESKNA
518
547










Molecular Recognition Features






MoRF SequenceStartStop




NANANA