<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16104

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAELGQQTVDFSMLVHRAAEDSFLLLKELVEQLKKSEQSDTEKKISILKYIQKTRQRMLRLDVVAKWCRQVPVVQYCQQLASTLSSHDTCFTQAADSLFFMHEGLQQARAPIYDVPSAIEVLLTGSYQRLPKCIEDMGVQSSLTEDQQKPALKKLETLLRSRLLEITLPKEISEVKVSDGTVHLCVNGEFKVILTLGYRGHLSMWRILHLELLVGEKSGHVKLEESRRHVLGDDLERRMAAAENPFLLLYSILHELCVALIMDTVLRQVQALRQGRWRDAIRFELISDGPAGQGGSAGPTPMSQDGETDSSNKKIPGLKILYWLDFGKNNGGSDSGLCPYIKIEPSQVLQVKCLHSTFVIDPLTGKEADFSLDQSCVDVEKLLLRVISCNRYTRLLVILEELRKIGQICQAADDVLLQCYEDNSDLDMRKKDNKSNPRAFGGKEVLRVRAYNSSYITLGINIRSGHFYLQSSRNVLTASSLSECEEALNQGGMTAVEVFISLRSKSILRLIASVGKFLGLQVYEQGLAAVKIPNALLNGSGVLLMGLPQCGGSYFLLIQLDHNFKALFQLLETQQDSNGKFLTGGKLNQVIRFNDIDIDRTQMLRDESTLSLLERGNLISSFPNVVGSNQTSERGLLSECGLDASMQIAAGSPQSSFSSVVNELFALEKGMSAPPFPVRSNLSSSFITSPTINLGSVPINYQKTKFGITSPKWDGSLQQSSPGRSPALQKLSSSKSEQDITSLRSAHAVEAGSAINEHQVVYSSRSSRLLHPLRPTGPSVTPVRNVIDLGSPTTTTRNAIGSSRAGQAPESGFPNKSNYEVSKYDINPRKRSISDLLSLVPSLEGTKKRRKLSETALRHTPASQVARSSDFIGKIDGCSYGNLLAEANKGNAPSSIYVTALLHVVKHCSLCIKHARLTSQMAALDIPYIEEAGLQIPSSNVWFRLPFAREMSWQHLCLRLGRPGSMSWDVKIDDQHFRDLWELQKGSTNTPWGSGVRIATASDIDSHIRYDSDGVILTYESVEDDSIKKLVADISRLFNARLFSLGMRELLGVRTDDKPEEGSATLENKTSIGSKVDVEFPDKISEQLRKAFRIEAVGLMSLWFSFGPGVLARFVVEWESGKEGCTMHVSPDQLWPHTKFLEDFINGAEVASLLDCIRLTAVPLHALAAATRPARAGPASGSLSAMPGSSPIPKQNAFVLPSSSLSNVNQTTPVPPAASSVASSVMVSLGSHALHGAAMLAAGRGGPGIVPSSLLPFDVSVVLRGPYWIRIIYRKDFAVDMRCFGGDHVWLQPATPPKEGHAVGGSLPCPQFRPFIMEHVAQELNGLEPNLSVGQQTVGLVNLNSPNPSLGSQLAVASGNRSANASGIVRPASLPGNHVTGLSRIGNGPMASSNLSASSGMPLRRSLGTGVPIHLRGELNTAFIGLGDDGGYGGGWVPLVALKKVLRGILKYLGVLWLFAQLPDLLKEILSSILKDNEGALLNLDQEQPALRFFVG
Length1496
PositionTail
OrganismAquilegia coerulea (Rocky mountain columbine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae> Aquilegia.
Aromaticity0.06
Grand average of hydropathy-0.125
Instability index48.48
Isoelectric point8.33
Molecular weight163150.92
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP16104
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.70|      15|      20|    1178|    1193|       1
---------------------------------------------------------------------------
 1178- 1193 (24.49/19.42)	PASgSLSAMPGSSPIP
 1201- 1215 (28.20/16.79)	PSS.SLSNVNQTTPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.11|      25|     154|    1125|    1156|       2
---------------------------------------------------------------------------
 1125- 1156 (37.99/45.89)	CtmhVSPDQLW..PHTKFLEdfinGAEVASLLDC
 1283- 1309 (48.12/32.90)	C...FGGDHVWlqPATPPKE....GHAVGGSLPC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     143.62|      41|     248|     797|     837|       5
---------------------------------------------------------------------------
  740-  784 (43.88/24.74)	...ITSLRSAHAVEAGsainehqvvYSSRSSRLL..HPLRPTGPSVTPVR
  797-  837 (67.39/42.33)	RNAIGSSRAGQAPESG.........FPNKSNYEVSKYDINPRKRSISDLL
  849-  876 (32.35/16.10)	RRKLSETALRHTPASQ.........VARSSDF.IGKID............
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.28|      25|     571|     127|     155|       6
---------------------------------------------------------------------------
  127-  153 (40.23/35.17)	YQRLPKCIEDmgVQSS.........LTEDQQKPALK
 1459- 1492 (35.05/16.81)	FAQLPDLLKE..ILSSilkdnegalLNLDQEQPALR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.32|      17|      22|     612|     628|      11
---------------------------------------------------------------------------
  612-  628 (31.00/19.10)	LLERGNLISSFPNVVGS
  636-  652 (24.32/13.13)	LLSECGLDASMQIAAGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.76|      30|      35|     517|     546|      12
---------------------------------------------------------------------------
  517-  546 (48.84/33.02)	FLGLQVYEQGLAAVKIPNALLNGSGVLLMG
  555-  584 (49.92/33.94)	FLLIQLDHNFKALFQLLETQQDSNGKFLTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     254.33|      77|     425|     235|     313|      14
---------------------------------------------------------------------------
   18-   60 (30.56/10.69)	......AAEDSFLLLKELVEQLKKSEQSD.TekkisI.LKYIQKTRQRMLR......................................
  235-  313 (125.10/76.37)	LERRMAAAENPFLLLYSILHELCVALIMD.T.....V.LRQVQALRQGRWRdAIRFELIS...DGpAGQGGSAGPTPMSQDGETDSSNK
  667-  738 (98.67/52.29)	LEKGMSAP..PF....PVRSNLSSSFITSpT.....InLGSVPINYQ.....KTKFGITSpkwDG.SLQQSSPGRSPALQKLSSSKSEQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP16104 with Med14 domain of Kingdom Viridiplantae

Unable to open file!