<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16098
| Description |
Uncharacterized protein |
| Sequence | MENPYSGGTWMMIPNNNNNNTTSINTPSSSTTSNPNQDLSHSHLQQQQQFLNQQQQQQRHLQQQQQQHHQSLASHFHLLHLVENLADVIENGTRDQHSDVLVNELTTNFDKCQQLLNSISGSISSKAMVNS |
| Length | 131 |
| Position | Middle |
| Organism | Aquilegia coerulea (Rocky mountain columbine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.969 |
| Instability index | 43.72 |
| Isoelectric point | 5.91 |
| Molecular weight | 14842.94 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16098
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.16| 13| 15| 41| 53| 1
---------------------------------------------------------------------------
41- 53 (26.38/11.27) HSHLQQQQQFLNQ
58- 70 (26.78/11.54) QRHLQQQQQQHHQ
---------------------------------------------------------------------------
|