<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16097
Description |
Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MENPYSGGTWMMIPNNNNNNTTSINTPSSSTTSNPNQDLSHSHLQQQQQFLNQQQQQQRHLQQQQQQHHQSLASHFHLLHLVENLADVIENGTRDQHSDVLVNELTTNFDKCQQLLNSISGSISSKAMTVEGQKRKLEESEQLLNQRRELIAKYRSSVDELVKADR |
Length | 166 |
Position | Middle |
Organism | Aquilegia coerulea (Rocky mountain columbine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.036 |
Instability index | 47.08 |
Isoelectric point | 6.11 |
Molecular weight | 19040.65 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16097
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.16| 13| 15| 41| 53| 1
---------------------------------------------------------------------------
41- 53 (26.38/11.32) HSHLQQQQQFLNQ
58- 70 (26.78/11.59) QRHLQQQQQQHHQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.79| 16| 27| 102| 117| 2
---------------------------------------------------------------------------
102- 117 (27.55/13.93) VNELTTNFDKCQQLLN
130- 145 (25.25/12.33) VEGQKRKLEESEQLLN
---------------------------------------------------------------------------
|