<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16087

Description Uncharacterized protein
SequenceMANEVTAVAIDKDKHSQAAVRWAVDNLLSSNPYIILIHVRVRNQSPNNSTTSPDTNRDKFEAEIKQLFLPYRGFCSRKGVRIKEVVLDDMDIGEAIVSYVDHNYINNIVVGASTRGFLQSWRLKNVDVPTCLLKSSPDFCSVYVIAKGKIMNLKTATRAPPYNAVQVRRPPSPLGRPAQLASDSSAPEDAMKTSHGPNSTSESSTSSLYTPRTSHGPNSNSESSNFSGSYGFRSGDTSHPTTSREFSNSSNGNSSASVIDAEMRRLRMELKQTMEMYNSACKEANSAKEKSLEVQQWKKDEARKVENARHAEEAALSLAKLEKAKAHAALEAAEKSKRLALLEAKRRRDFEMKSQTESEARSKVVNALEKNDIRYRKYDYEDIKIATGNFSESLKIGEGGYGPVYRATLDHTPVAVKVLRSDAAQGMKQFQQEVEVLSCIRHPNMVLLLGACPESGCLVYEYMENGSLEDRLFRRGGTPPIPWWIRFKIAAEIATGLLFLHQTKPEPLVHRDLKPANILLDRYYVSKISDVGLARLVPPSVADNVTQYHMTSAAGTFCYIDPEYQQTGMLGTKSDVYSLGVMLLQVITGRPPMGLTHHVERSIERGTFQDLVDPSVPNWPMEEAISFAKMALRCAELRRKDRPDLGSEILPELNRLRALGYSESNNIRNFNSSPNSYTSNSHLRSSHANQVS
Length692
PositionTail
OrganismAquilegia coerulea (Rocky mountain columbine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae> Aquilegia.
Aromaticity0.07
Grand average of hydropathy-0.518
Instability index43.58
Isoelectric point8.85
Molecular weight77117.29
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16087
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.25|      19|      23|     193|     215|       1
---------------------------------------------------------------------------
  195-  213 (38.38/23.63)	HGPNSTSESST.SSLYTPR...T
  215-  237 (29.86/17.01)	HGPNSNSESSNfSGSYGFRsgdT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.70|      22|      23|     287|     308|       2
---------------------------------------------------------------------------
  287-  308 (35.94/23.23)	AKEKSLEVQQWKKDEAR.KVENA
  311-  333 (27.76/16.51)	AEEAALSLAKLEKAKAHaALEAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.47|      17|      25|     335|     351|       3
---------------------------------------------------------------------------
  335-  351 (27.86/20.09)	KSKRLALLEAK....RRRDFE
  361-  381 (23.61/15.89)	RSKVVNALEKNdiryRKYDYE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.37|      20|     418|     238|     257|       4
---------------------------------------------------------------------------
  238-  257 (35.76/24.46)	SHPTTSREFSNSSNGNSSAS
  662-  681 (35.62/24.33)	SESNNIRNFNSSPNSYTSNS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16087 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TRAPPYNAVQVRRPPSPLGRPAQLASDSSAPEDAMKTSHGPNSTSESSTSSLYTPRTSHGPNSNSESSNFSGSYGFRSGDTSHPTTSREFSNSSNGNSSASVIDAEMRRLRMELKQTMEMYNSACKEAN
157
285










Molecular Recognition Features






MoRF SequenceStartStop




1) PYIILIHVRVR
32
42