<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16085

Description Uncharacterized protein
SequenceMANEVTAVAIDKDKHSQAAVRWAVDNLLSSNPYIILIHVRVRNQSPNNSTTSPDTNRDKFEAEIKQLFLPYRGFCSRKGVRIKEVVLDDMDIGEAIVSYVDHNYINNIVVGASTRGFLQSWRLKNVDVPTCLLKSSPDFCSVYVIAKGKIMNLKTATRAPPYNAVQVRRPPSPLGRPAQLASDSSAPEDAMKTSHGPNSTSESSTSSLYTPRTSHGPNSNSESSNFSGSYGFRSGDTSHPTTSREFSNSSNGNSSASVIDAEMRRLRMELKQTMEMYNSACKEANSAKEKSLEVQQWKKDEARKVENARHAEEAALSLAKLEKAKAHAALEAAEKSKRLALLEAKRRRDFEMKSQTESEARSKVVNALEKNDIRYRKYDYEDIKIATGNFSESLKIGEGGYGPVYRATLDHTPVAVKVLRSDAAQGMKQFQQEVEVLSCIRHPNMVLLLGACPESGCLVYEYMENGSLEDRLFRRGGTPPIPWWIRFKIAAEIATGLLFLHQTKPEPLVHRDLKPANILLDRYYVSKISDVGLARLVPPSVADNVTQYHMTSAAGTFCYIDPEYQQTGMLGTKSDVYSLGVMLLQVITGRPPMGLTHHVERSIERGTFQDLVDPSVPNWPMEEAISFAKMALRCAELRRKDRPDLGSEILPELNRLRALGYSESNNIRNFNSSPNSYTSNSHLRSSHANQIQDH
Length694
PositionTail
OrganismAquilegia coerulea (Rocky mountain columbine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae> Aquilegia.
Aromaticity0.07
Grand average of hydropathy-0.530
Instability index43.87
Isoelectric point8.78
Molecular weight77424.60
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP16085
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.25|      19|      23|     193|     215|       1
---------------------------------------------------------------------------
  195-  213 (38.38/18.91)	HGPNSTSESST.SSLYTPR...T
  215-  237 (29.86/13.56)	HGPNSNSESSNfSGSYGFRsgdT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.70|      22|      23|     287|     308|       2
---------------------------------------------------------------------------
  287-  308 (35.94/28.42)	AKEKSLEVQQWKKDEAR.KVENA
  311-  333 (27.76/20.23)	AEEAALSLAKLEKAKAHaALEAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.47|      17|      25|     335|     351|       3
---------------------------------------------------------------------------
  335-  351 (27.86/22.08)	KSKRLALLEAK....RRRDFE
  361-  381 (23.61/17.48)	RSKVVNALEKNdiryRKYDYE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.37|      20|     418|     238|     257|       4
---------------------------------------------------------------------------
  238-  257 (35.76/18.49)	SHPTTSREFSNSSNGNSSAS
  662-  681 (35.62/18.40)	SESNNIRNFNSSPNSYTSNS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP16085 with Med32 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) TRAPPYNAVQVRRPPSPLGRPAQLASDSSAPEDAMKTSHGPNSTSESSTSSLYTPRTSHGPNSNSESSNFSGSYGFRSGDTSHPTTSREFSNSSNGNSSASVIDAEMRRLRMELKQTMEMYNSACKEAN
157
285

Molecular Recognition Features

MoRF SequenceStartStop
1) PYIILIHVRVR
32
42