<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16069
Description |
Uncharacterized protein |
Sequence | MAANFWASSHYKQLLEQEEVDVVHSPDKEKGFTLEDFKLIKMQMSNYIAKLAQYVKVRQRVVATAITYMRRVYTRKSMTEYEPHLVAPTCLYLASKAEESTVQARLLVFYIKKQYNDEKYRYEIKDILEMEMKVLEALNYYLVVYHPYRPLSQLLQDAGMTELTQLSWGLLNDTYKMDVILIYPPYMIALACIYIASVLKEKDTTAWFEELRADMNVVKNISMELLDFYDSQKVTADERIGAALHKLALKP |
Length | 251 |
Position | Kinase |
Organism | Aquilegia coerulea (Rocky mountain columbine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.186 |
Instability index | 40.52 |
Isoelectric point | 6.24 |
Molecular weight | 29406.90 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16069
No repeats found
|