<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16069
| Description |
Uncharacterized protein |
| Sequence | MAANFWASSHYKQLLEQEEVDVVHSPDKEKGFTLEDFKLIKMQMSNYIAKLAQYVKVRQRVVATAITYMRRVYTRKSMTEYEPHLVAPTCLYLASKAEESTVQARLLVFYIKKQYNDEKYRYEIKDILEMEMKVLEALNYYLVVYHPYRPLSQLLQDAGMTELTQLSWGLLNDTYKMDVILIYPPYMIALACIYIASVLKEKDTTAWFEELRADMNVVKNISMELLDFYDSQKVTADERIGAALHKLALKP |
| Length | 251 |
| Position | Kinase |
| Organism | Aquilegia coerulea (Rocky mountain columbine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.186 |
| Instability index | 40.52 |
| Isoelectric point | 6.24 |
| Molecular weight | 29406.90 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16069
No repeats found
|