<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16066
| Description |
Uncharacterized protein |
| Sequence | MECAVEGIIETQYVEAVEILLQGLCGVPKERFRIHELCLKSGPNLGSVSSEVRLLCDLEQPVPTWTVRHVGGAMRGAGAEQISVAVRTMIESKASKNVLRFFYALGYKLDHELLKVGFSFHFQKGAHLKVSVTSVKKMPKLHAVDEAIPVTPGIQLVEVTAPAAADNYNEVVAAVSSFSEYLAPLLHLSKPGVSVGVVPTAAAAAASLMSDRGGKTL |
| Length | 217 |
| Position | Head |
| Organism | Aquilegia coerulea (Rocky mountain columbine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.229 |
| Instability index | 32.18 |
| Isoelectric point | 7.05 |
| Molecular weight | 23179.69 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16066
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.70| 14| 37| 152| 165| 1
---------------------------------------------------------------------------
152- 165 (25.38/15.28) PGIQL.VEVTAPAAA
191- 205 (20.33/11.03) PGVSVgVVPTAAAAA
---------------------------------------------------------------------------
|