<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16052
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSAENNNKDDDISTLTPPNLYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQQPEYIKFIMYPHCLYFLELLQNANFRSAMAHPASKEIAHRQQFFFWKNYRNNRLKHIALKPLPEPVATPVASAPPSTLPATSTVAAAPAQALSPMQYGVQPGPVLAKNDMRNVGGDRRKRKERTS |
| Length | 197 |
| Position | Middle |
| Organism | Aquilegia coerulea (Rocky mountain columbine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.592 |
| Instability index | 49.84 |
| Isoelectric point | 8.98 |
| Molecular weight | 22740.63 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16052
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.60| 20| 27| 31| 55| 1
---------------------------------------------------------------------------
31- 50 (36.54/26.01) FLLELEFVQCLANPTYIHYL
61- 80 (39.05/17.04) FIGYLKYLQYWQQPEYIKFI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.40| 25| 26| 86| 110| 2
---------------------------------------------------------------------------
86- 110 (40.51/22.89) LYFLELLQNANFRSAMAHPASKEIA
115- 139 (44.89/25.99) FFFWKNYRNNRLKHIALKPLPEPVA
---------------------------------------------------------------------------
|