<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16046
Description |
Uncharacterized protein |
Sequence | MNKGGGVGGGGGGSAPTTAAAYAAAAQKQKNLLQRVDNDITNIVDNFSFLVNVARVNDPPVRNSQEAFMMEMRAARTVQAADSLLKLVSELKQTAIFSGFASLNEHVEQRTIEFNQHAERTDCMLAKIGEEAAASLKELESHYYSSIQKTNQLEP |
Length | 155 |
Position | Head |
Organism | Aquilegia coerulea (Rocky mountain columbine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Ranunculaceae> Thalictroideae>
Aquilegia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.366 |
Instability index | 39.29 |
Isoelectric point | 5.61 |
Molecular weight | 16759.60 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16046
No repeats found
No repeats found
|