Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MEKDLTAIEWRSDQWIYQFGGLRPENVLEYFSQSPFWDPSSNNAVLKMQTQFNALQQGSYDLKNMVGVEFAVTHQEPPMLFIITKFRRSSPTKVTPIAAYYILDGNAYEAPSLHSIVSTRMLSSIKRVENAFEIARSHAVFHPSVGYSWNESAELKAARKNALKDFQS |
Length | 168 |
Position | Head |
Organism | Coemansia reversa (strain ATCC 12441 / NRRL 1564) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Kickxellomycotina> Kickxellomycetes> Kickxellales> Kickxellaceae> Coemansia. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.373 |
Instability index | 54.60 |
Isoelectric point | 6.91 |
Molecular weight | 19200.49 |
Publications | PubMed=25977457 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16029 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 105.40| 33| 106| 23| 56| 1 --------------------------------------------------------------------------- 23- 56 (56.15/35.86) RPENVLEYFSQSPFWDPS.....SNNAVLKMQTQfNALQ 127- 164 (49.25/26.90) RVENAFEIARSHAVFHPSvgyswNESAELKAARK.NALK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LFIITKFRR 2) PIAAYYILD | 80 96 | 88 104 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab