<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16026
| Description |
Uncharacterized protein |
| Sequence | MKQLDFGRADVELEVSAITILSDEEQGPVSKFQVFDRITYDSKIIWSSISGFSVEHRILKMVQWFCLFENLFSATCSICHQHLQIDPRTSQHLPPLWRDADIKGDGPCKTFHYGCLESI |
| Length | 119 |
| Position | Tail |
| Organism | Coemansia reversa (strain ATCC 12441 / NRRL 1564) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Kickxellomycotina>
Kickxellomycetes> Kickxellales> Kickxellaceae> Coemansia.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.135 |
| Instability index | 43.23 |
| Isoelectric point | 5.41 |
| Molecular weight | 13678.48 |
| Publications | PubMed=25977457
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16026
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.84| 14| 17| 30| 46| 1
---------------------------------------------------------------------------
30- 46 (21.79/24.27) SKFQVFDRITydsKII.W
50- 64 (23.04/15.03) SGFSVEHRIL...KMVqW
---------------------------------------------------------------------------
|