<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16014
| Description |
Uncharacterized protein |
| Sequence | MSSRLRPSLPASSLQQGLLRLYFCLKHMAERHPVDQQQTSEPQVQSPASRDDMIACVMALEAALLPCTRAPGDRPFSTSLSSE |
| Length | 83 |
| Position | Head |
| Organism | Capsicum chinense (Scotch bonnet) (Bonnet pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.324 |
| Instability index | 95.40 |
| Isoelectric point | 6.71 |
| Molecular weight | 9142.38 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16014
No repeats found
|