<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16005
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MATTPMMPPNADGSAPAAPPLPGTDMTSICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNEQLRARAIHPLDFSHISKMTGVEYTLSEVMEPHLFVIRKQKRDSPEKVTPMLTYYILDGSIYQAPQLCNVFASRLGRALYHISKAFGTASSKLEKIGYVDSENDSPASEAKPAKEAIDFKELKRVDHILASLQRKLPPVPAPPPFPEGYAPPSTSEPSENQQPEAQPPPIDPIIDQGPSKRMKV |
| Length | 247 |
| Position | Head |
| Organism | Capsicum chinense (Scotch bonnet) (Bonnet pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.460 |
| Instability index | 66.73 |
| Isoelectric point | 5.76 |
| Molecular weight | 27573.16 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16005
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.83| 19| 106| 4| 44| 2
---------------------------------------------------------------------------
4- 30 (35.08/26.02) TPMMPPNA.DGSAPAAPPLpgtdmtsiC
112- 131 (33.75/ 8.97) TPMLTYYIlDGSIYQAPQL........C
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.44| 16| 23| 201| 216| 3
---------------------------------------------------------------------------
201- 216 (34.90/14.02) PVPAPPPF.PEGYAPPS
226- 242 (28.55/10.26) PEAQPPPIdPIIDQGPS
---------------------------------------------------------------------------
|