<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15984

Description Uncharacterized protein
SequenceMDEAHPLNTPMVVQSLDVTKDPFRRQEKQEKILGSEVPYLSAIDALMYLANSTRPDIVASVNLSVRRDTLIWHVRVYTRVYTQELGHELMRIAVMFEEKVYTAATSLLSRHDVCILTEIYLILQQDYLQRICLKMRTIDIRSQNRVINPLLPNAASSGPNAHGPEAVSYETISGPVVSDEDEDAEDVSKEDSLEEVAMTKERKSAVGHKENVKVGENETGNANGADWQEEAYQKIKSMREMYLSELFTVKLLLKCRSLQHQESQGANGNKYISFEHKSDMDNGRNASSADRETNLDSTSQMGNADGADWYEELYLKVLFALVYLFVQDFVCFNVDFDELSALTTNPFILSHFISEIELMKICNADQDSEGEALNSEITDLYQRIAFAVQLDSLPQRLQHEQVEKLKMFKSNLEHIMIFLQLNKHDIQLTHKEKLCSVEKHISFFLLKRLRKPTSSPSWGGQGQLPLSCMQLQQPQSLDVQANPPTQPVHGFMPAMQQNNLTNLQHLSLSGVNTVQPGSGVATGSLPQNPVNYSPQQVNISSLSSQSGTNPVQANFGSLQQNSSIPQQSLFELHEQQMLQGQQLRQMYEQMQQQTFHSQQLMQHQQLFHRHQLLQQQAMQQQLMQQQQEMQLQIVQLRARQMSRLHQVTDANDLMMRQQMGMNMEVLQQQQSVGQHVGSLHPQLKSGISLP
Length690
PositionTail
OrganismCapsicum chinense (Scotch bonnet) (Bonnet pepper)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
Aromaticity0.06
Grand average of hydropathy-0.497
Instability index52.06
Isoelectric point5.54
Molecular weight78504.98
Publications
PubMed=29089032

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15984
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.87|      19|      20|     527|     546|       1
---------------------------------------------------------------------------
  527-  546 (31.80/19.00)	QNPV..NYSPQQVNiSSLSSQS
  548-  568 (30.06/13.84)	TNPVqaNFGSLQQN.SSIPQQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     131.64|      21|      21|     573|     593|       2
---------------------------------------------------------------------------
  573-  593 (40.51/21.00)	HEQQM............LQGQQLRQMYEQMQQQ
  596-  616 (40.22/20.79)	HSQQL............MQHQQLFHRHQLLQQQ
  618-  632 (22.28/ 7.91)	.................MQ.QQLMQQQQEMQLQ
  637-  669 (28.64/12.48)	RARQMsrlhqvtdandlMMRQQMGMNMEVLQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     140.77|      44|      71|     201|     254|       3
---------------------------------------------------------------------------
  201-  254 (70.81/72.87)	ERKSAVGHKENVKVGENET........GNANGADWQEEAYQKIksmremylseLFT.VKLLLK
  275-  327 (69.96/50.22)	EHKSDMDNGRNASSADRETnldstsqmGNADGADWYEELYLKV..........LFAlVYLFVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.29|      23|      28|     396|     423|       4
---------------------------------------------------------------------------
  396-  423 (31.24/35.10)	RLQHEqvEKLKmfkSNLEHIMIFL..QLNK
  427-  451 (37.05/23.70)	QLTHK..EKLC...SVEKHISFFLlkRLRK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.07|      27|      27|     461|     487|       5
---------------------------------------------------------------------------
  466-  493 (46.62/25.72)	LSCMQLQQPQSLDVQANPPTQP....vHGFMP
  495-  526 (40.45/21.34)	MQQNNLTNLQHLSLSGVNTVQPgsgvaTGSLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.94|      12|      29|     330|     342|       6
---------------------------------------------------------------------------
  330-  342 (18.21/18.68)	VCfNVDFD.ELSAL
  361-  373 (18.73/12.17)	IC.NADQDsEGEAL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15984 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QPGSGVATGSLPQNPVNYSPQQVNISSLSSQS
2) VSDEDEDAEDVSKEDSLEEVAMTKERKSAVGHKENVKVGENETGNANGADWQEE
515
177
546
230










Molecular Recognition Features






MoRF SequenceStartStop




NANANA