<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15981
| Description |
Uncharacterized protein |
| Sequence | MNHLGLILDVSSGDKSKVVALWLEMEKRDTLIGHVRVYTGVYTEEVVQELMRIAVMFEEKVYASATSLQDHLQKISFKMRTIDIRYQNRVTNPLLPNAASSGPNAHGAEMTTEAVSYETISGPVVSDGDEDAEDVSKEDSLEEVAMTKEQKSAVGHKENVKVGENEVICVVFFVVQLPVMNYTLESI |
| Length | 187 |
| Position | Tail |
| Organism | Capsicum chinense (Scotch bonnet) (Bonnet pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.166 |
| Instability index | 30.55 |
| Isoelectric point | 4.76 |
| Molecular weight | 20780.35 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP15981
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.35| 18| 18| 101| 118| 2
---------------------------------------------------------------------------
101- 118 (32.41/20.35) SGPNAHGAEMTTEAVSYE
121- 138 (30.93/19.15) SGPVVSDGDEDAEDVSKE
---------------------------------------------------------------------------
|