<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15945
| Description |
Mediator of RNA polymerase II transcription subunit 19a |
| Sequence | MDPDSKRFGRGPGELTGAVDLISHFKLLSHHEFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQDTSLSRETSSCIQPFDLDALGEAFQLREAAPVDLPHSEKGIPTVAGKSKSESKDKEKKHKKHKDKDKEKDKEHKKHKHRHRDRSKDKDKDKKRDKSVHHDSGADHSKKHHEKKRKHDGEEELNDVHKHKRSKHKSSKIDEIGAIKVAG |
| Length | 219 |
| Position | Head |
| Organism | Capsicum chinense (Scotch bonnet) (Bonnet pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.386 |
| Instability index | 40.30 |
| Isoelectric point | 9.31 |
| Molecular weight | 25045.80 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15945
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.56| 14| 33| 140| 172| 2
---------------------------------------------------------------------------
159- 181 ( 8.78/ 8.03) DKDKKrdksvhHDSgAdhSKKHH
182- 195 (22.78/11.51) EKKRK......HDG.E..EELND
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.55| 9| 45| 149| 158| 3
---------------------------------------------------------------------------
149- 158 (14.01/ 9.05) HRHRdRSKDK
197- 205 (18.54/ 7.59) HKHK.RSKHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 67.46| 17| 21| 62| 78| 4
---------------------------------------------------------------------------
49- 61 (13.75/ 8.02) ....LHNVVGDTEIRKG
62- 78 (27.84/23.59) EGMQLDQLIQDTSLSRE
84- 99 (25.87/21.42) QPFDLDALGEAFQL.RE
---------------------------------------------------------------------------
|