<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15938

Description Uncharacterized protein
SequenceMELLTPSPNFPSGFSSMATFKRGFYRTSQIFITPQSSEIVVEEQQEEEGSRVYVAVGKSVDKGVASVQWACKTFGNSEICILHVLQPSPYIPTLLGRLPATQANAEVVSTFRNAEREEARKLLSRFLSVCCKSKVKASVAIVESDQVLKGILDFVNKHNIRKLIIGAIPDCVKVKKSSWKASYAATNFPSFCEIFFVYKGRLVWSRQHPEYSSFIAPISPNTREVAVDVCGLRSRSLKSCKNEAIRFPECARSSSSRDLLPSGIKSLISSETDLRFKSFSSTSRSNLISAPALSISTSSTPDSSCASSAEQLVSLDAEMESLYKQLAEVSTEFESSRTEAFAEIHKRKKLEAEAAESLRKVKAFESAHAHEVELRKEAEDALGATLLEKEKLLKERKEITYELRKAMRNIALLDSRTQEANRQREEIAGELSLIHSSLVTLRKEKQKLQQQTGEAVHWINSWKNRGNDGGLRPNYLTECAESLKLVEFSLSDLETATCNFSESFRIGQGGYADVFKGEFSDKTVAIKQLHPHNMQRQSQFFEQVEILAKLHHPHLVTLLGMCPEVWCLVYEYFSGLSLQDRLFGKNNISPMNWKMRARILAEIASALLYLHSYPEKIVHGDLRPENVLLDSTGSCKVCDVWISGLIPKQALRCPSFDRLSEPKGLFSYTDPEFHVTGALTPKSDIYALGLIILQMLTGRTLVGLVSEVRRAVSCAQLESLLDPSAGEWSTFVSRRLAELALQCCEVNSRDRPELTPALVMELENLNELEEQSVPSFFLCPIRQDIMHDPQVAADGFTYEGEAIQGWLESGHDTSPMTNLKLRHLELTPNHALRLAIKDWVCNL
Length843
PositionTail
OrganismCapsicum chinense (Scotch bonnet) (Bonnet pepper)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
Aromaticity0.08
Grand average of hydropathy-0.241
Instability index50.87
Isoelectric point6.51
Molecular weight94408.81
Publications
PubMed=29089032

Function

Annotated function Functions as an E3 ubiquitin ligase. 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15938
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.05|      23|      26|     337|     362|       1
---------------------------------------------------------------------------
  337-  362 (29.43/26.75)	RTEafaEIHKRKKLE.AEAAESLRKVK
  368-  391 (29.62/17.89)	HAH...EVELRKEAEdALGATLLEKEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     137.59|      39|     172|     431|     494|       2
---------------------------------------------------------------------------
  455-  493 (70.92/69.51)	AVHWINSWKNRGNDGGLRP.NYLTECAESLKLVEFSLSDL
  606-  645 (66.67/25.99)	ALLYLHSYPEKIVHGDLRPeNVLLDSTGSCKVCDVWISGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.41|      16|      17|     280|     296|       6
---------------------------------------------------------------------------
  253-  268 (24.66/13.63)	SSSSR.DLLPSGIKSLI
  280-  296 (21.74/16.57)	SSTSRsNLISAPALSIS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15938 with Med32 domain of Kingdom Viridiplantae
Unable to open file!