<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15922
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MIIYLTRSQKKQFHKYEFLSPQITSLIFQSCLITLVLLLVKVIKEPDGDDADDAAERRRXPPLPGTDMTSICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNEQLRARAIHPLDFSHISKMTGVEYTLSEVMEPHLFVIRKQKRDSPEKVTPMLTYYILDGSIYQAPQLCNVFASRLGRALYHISKAFGTASSKLEKIGYVDSENDSPASEAKPAKEAIDFKELKRVDHILASLQRKLPPVPAPPPFPEGYAPPSTSEPSENQQPEAQLPPIDPIIDQGPSKRMKV |
| Length | 289 |
| Position | Head |
| Organism | Capsicum annuum (Capsicum pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.392 |
| Instability index | 66.91 |
| Isoelectric point | 6.33 |
| Molecular weight | 32754.22 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP15922
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.38| 20| 30| 64| 85| 1
---------------------------------------------------------------------------
64- 85 (37.07/31.78) PGTDMTsiCFRDQLWLNT.YPLD
97- 117 (37.32/25.12) PFYDWT..CNNEQLRARAiHPLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.94| 26| 64| 120| 150| 2
---------------------------------------------------------------------------
120- 150 (38.47/47.24) HISKMTGveyTLSEVMEPHLFVirKQKRDSP
186- 211 (46.47/36.66) HISKAFG...TASSKLEKIGYV..DSENDSP
---------------------------------------------------------------------------
|