Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MIIYLTRSQKKQFHKYEFLSPQITSLIFQSCLITLVLLLVKVIKEPDGDDADDAAERRRXPPLPGTDMTSICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNEQLRARAIHPLDFSHISKMTGVEYTLSEVMEPHLFVIRKQKRDSPEKVTPMLTYYILDGSIYQAPQLCNVFASRLGRALYHISKAFGTASSKLEKIGYVDSENDSPASEAKPAKEAIDFKELKRVDHILASLQRKLPPVPAPPPFPEGYAPPSTSEPSENQQPEAQLPPIDPIIDQGPSKRMKV |
Length | 289 |
Position | Head |
Organism | Capsicum annuum (Capsicum pepper) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.392 |
Instability index | 66.91 |
Isoelectric point | 6.33 |
Molecular weight | 32754.22 |
Publications | PubMed=29089032 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP15922 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.38| 20| 30| 64| 85| 1 --------------------------------------------------------------------------- 64- 85 (37.07/31.78) PGTDMTsiCFRDQLWLNT.YPLD 97- 117 (37.32/25.12) PFYDWT..CNNEQLRARAiHPLD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 84.94| 26| 64| 120| 150| 2 --------------------------------------------------------------------------- 120- 150 (38.47/47.24) HISKMTGveyTLSEVMEPHLFVirKQKRDSP 186- 211 (46.47/36.66) HISKAFG...TASSKLEKIGYV..DSENDSP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HKKIKHRD 2) TELWSRFFPE | 66 102 | 73 111 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab