<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15919
Description |
Mediator of RNA polymerase II transcription subunit 22a |
Sequence | MNKGANVGGGGPXXXXXXXXXXXXXXXXXXXXXXXGQKQKSLLQRLDADIGNIVDNYGFIVNAARVNDPPVRNSQEAFMMEMRASRMVHAADSLLKLVSELKQTAMFSGFASLNDHVEQRTEEFMEQAEKTECMLSRIGEEAAASLKELESHYYSSAERTSSLPSYGEETMP |
Length | 172 |
Position | Head |
Organism | Capsicum annuum (Capsicum pepper) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.521 |
Instability index | 52.85 |
Isoelectric point | 4.98 |
Molecular weight | 16409.22 |
Publications | PubMed=29089032
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15919
No repeats found
|