<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15916
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MDYCKVKRMYKDLDDRRQRFLLELEFVQCLANPTYIHYNFYFPSLSSLSIMIIYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNPAFHNAMAHPANKVKMAHRQQFDFWKNFRNSRLKHILRRPLPEPATAPPTSAPPALLPTSVAPPAAPPPAPSPVTAAALSPMQYAIPPGFGLAKTGPRNASVDRRKRKYFISSFTFLLL |
| Length | 218 |
| Position | Middle |
| Organism | Capsicum annuum (Capsicum pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.15 |
| Grand average of hydropathy | -0.239 |
| Instability index | 68.08 |
| Isoelectric point | 9.75 |
| Molecular weight | 25412.40 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP15916
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.73| 13| 18| 140| 152| 1
---------------------------------------------------------------------------
140- 152 (26.44/11.00) LP....EPATAPPTSAP
156- 172 (23.29/ 8.93) LPtsvaPPAAPPPAPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.22| 16| 18| 73| 88| 3
---------------------------------------------------------------------------
73- 88 (32.17/17.38) LQYWQRPEYIKFIMYP
94- 109 (29.05/15.13) LELLQNPAFHNAMAHP
---------------------------------------------------------------------------
|