<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15913
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSTATYPPPPPYYRLYKDYLQDPKSAPEPPPPIEGTYVLFGSNYTTDDALPNLEEQGVRQLYPKGPNVDFKKELRALNRELQLHILELADVLVERPSQYARRVEEISLIFKNLHHLLNSLRPHQVINW |
| Length | 128 |
| Position | Middle |
| Organism | Capsicum annuum (Capsicum pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.628 |
| Instability index | 62.51 |
| Isoelectric point | 6.06 |
| Molecular weight | 14894.78 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP15913
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.55| 13| 21| 4| 16| 1
---------------------------------------------------------------------------
4- 16 (29.95/11.51) ATYPPPP..PYYRLY
26- 40 (23.60/ 7.86) APEPPPPieGTYVLF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.80| 19| 23| 80| 98| 2
---------------------------------------------------------------------------
80- 98 (31.18/22.21) ELQLHILELADVLVE.RPSQ
105- 124 (29.62/20.78) EISLIFKNLHHLLNSlRPHQ
---------------------------------------------------------------------------
|