<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15909
Description |
Uncharacterized protein |
Sequence | MEGKRHCILISASNPYPLPTPVYRPQMQKLQQNENIEAQTDSRLSDAETVAKAFPQCSISLSVICPKKLPKLRATYDAYNKYGRFISIITVNGLAGAVLIVPEDKFNKGWEEVTDRIERFINRGSIVLQTNSRTLKEGELMTHYYNDKEKYSEAVTKSRWSQKSAGRDPKQSTKCNDTQKNDLPYRCLVGSVQENDEIPMQNDVRSWVHQNW |
Length | 212 |
Position | Unknown |
Organism | Capsicum annuum (Capsicum pepper) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.750 |
Instability index | 45.81 |
Isoelectric point | 8.88 |
Molecular weight | 24316.26 |
Publications | PubMed=29089032
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP15909
No repeats found
|