<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15907

Description U-box domain-containing protein 35
SequenceMEENDISKMEGHGTMQSPISSVVAIAITGNKNSRYVVKWALDKFIPEGETRFMLLHVRPEITAVPTPMGNLIPIAQVREDVADAFRKEVELQASEKLLPYKTMCSRRQVQVGVVQIESNDVINAIAGVVSKCSINKLVIGTSTPGLFSRGRNLSASISDTAPTFCTVYAVSKGKLSSVRPSTTENNRFLVDDSSDTSSSSNNSTGHSFSSQTERTDRDHNSNAPAFYSHLYSPTNQPQRYQAKSPVQQALQTLLHKRTKFSRNIQSISSSVDIGEAFQTLSIKSNSPSHKRENLDEVIHPRALSVAIGEAEDENSCYFSSLGITDLYNRASSFKKAKVDNQTWSTSPSCTSGAPTNSSTGSQVNINYDLEKLRIELRHIQGMYAIAQTEAIDASQKLNEFQKLRVEEANKLKQIILKAEEAKEVAEQEKLKCETAKKEADYAMECVEREAEQRRAAESIANREARTKEKLEKLLVLPLRHYQEFTWEEIVTASSSFSEDLKIGMGSYGMVYKCYLHHTTAAVKVLHCAEAHRTKQFQQELEVLSKIHHPHLLFLLGACPECGCLVYEYMQNGSLEDRLTRKNNTPPLPWFDRVRIAWEVASALAFLHNTKPKPIIHRDLKPANILLDHNLVSKIGDVGLSTMVQSDSSSAMTTFKDTSPVGTLCYIDPEYQRTGLVSTKSDVYAFGMVILQLLSAKRAIALAHMVEMAIEEDNLVELLDKEAGEWPLQETKELAVLALKCTELRRRDRPDLKYEVLPVLERLKEVADRARHLKYSQPPPPSHFKCPLLKEVIKDPYVAADGYTYDRKAIESWLMVNDNSPVTNLPLPHKHLLPNYALLSAIKEWKSGNH
Length849
PositionTail
OrganismCapsicum annuum (Capsicum pepper)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
Aromaticity0.07
Grand average of hydropathy-0.419
Instability index48.12
Isoelectric point6.96
Molecular weight95150.13
Publications
PubMed=29089032

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP15907
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.60|      22|      31|     255|     276|       2
---------------------------------------------------------------------------
  255-  276 (38.19/24.82)	HKRTKFSRNIQSISSSVDIGEA
  289-  310 (38.42/25.01)	HKRENLDEVIHPRALSVAIGEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     101.33|      28|      28|     402|     429|       3
---------------------------------------------------------------------------
  402-  429 (40.92/26.19)	KLRVEEA...NKL.KQIILKAEEAKEVAEQEK
  431-  454 (32.92/19.69)	..KCETA...KKE.ADYAMECVE.RE.AEQRR
  458-  488 (27.49/15.26)	SIANREArtkEKLeKLLVLPLRHYQEFTWEE.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     103.00|      30|     152|     176|     205|       5
---------------------------------------------------------------------------
  176-  205 (49.82/33.65)	SSVRPSTTENNRFLVDDSSDTSSSSNNSTG
  331-  360 (53.18/36.44)	SSFKKAKVDNQTWSTSPSCTSGAPTNSSTG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP15907 with Med32 domain of Kingdom Viridiplantae

Unable to open file!